AHP2

Histidine-containing phosphotransfer protein 2

156 amino acids

Functions as two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulators (B-type ARRs). Plays an important role in propagating cytokinin signal transduction through the multistep His-to-Asp phosphorelay.

17.476 kDa

MDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQDDGSPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGASVHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCVRCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQVDIN

AHP2

Histidine-containing phosphotransfer protein 2

149 amino acids

Functions as two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulators (B-type ARRs). Plays an important role in propagating cytokinin signal transduction through the multistep His-to-Asp phosphorelay (By similarity). Functions as positive regulator of the cytokinin signaling pathway. May play a regulatory role in salt and drought tolerance during plant development (PubMed:24578505).

16.811 kDa

MAAAALRDQLTALLSSMFSQGLVDEQFQQLQMLQDEGGTPGFVSEVVTLFCDDADRIINEIATLLEQPVVNFDKVDAYVHQLKGSSASVGAQKVKFTCMQFRQFCQDKSRDGCLMALAVVRNDFYDLRNKFQTMLQLEQQIQAYDPKQQ