agl12

Low-salt glycan biosynthesis protein Agl12

310 amino acids

Lyase involved in N-glycan biosynthetic pathway that takes place under low-salt conditions (1.75 M instead of 3.4 M). Participates in the formation of the tetrasaccharide present at 'Asn-532' of S-layer glycoprotein Csg, consisting of a sulfated hexose, 2 hexoses and rhamnose. Involved in the addition of final rhamnose (sugar 4) of the tetrasaccharide on the dolichol phosphate carrier.

Belongs to the NAD(P)-dependent epimerase/dehydratase family. dTDP-glucose dehydratase subfamily.

34.141 kDa

MDVLVTGGAGFIGSNFVRYLLDNSDDSVVTLDALTYAGSRDNLAGYLDHPNHRFVEGDIRDRELVDDLVADADVIVNFAAESHVDRSIGGAEPFVSTNVQGTQTLLDAALDADIDRFLQISTDEVYGEIHDGKFTEDDPLAPRNPYSATKAGADLLVRSYRETHDLPTLITRTCNNFGPRQHPEKLIPKFIQRAANGETLPVYGDGSNVREWIYVEDNCAALDVVLREGDIGEVYNIGSGVELSNLETTEKILEAVGGSEDQIEFVEDRAGHDQRYAIDATKTKALGWEPEWSFEDGLEACVDYYLGDDE

AGL12

Agamous-like MADS-box protein AGL12

211 amino acids

Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY.

23.919 kDa

MARGKIQLKRIENPVHRQVTFCKRRTGLLKKAKELSVLCDAEIGVVIFSPQGKLFELATKGTMEGMIDKYMKCTGGGRGSSSATFTAQEQLQPPNLDPKDEINVLKQEIEMLQKGISYMFGGGDGAMNLEELLLLEKHLEYWISQIRSAKMDVMLQEIQSLRNKEGVLKNTNKYLLEKIEENNNSILDANFAVMETNYSYPLTMPSEIFQF