ADRM1

Proteasomal ubiquitin receptor ADRM1

407 amino acids

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. Within the complex, functions as a proteasomal ubiquitin receptor. Engages and thus activates 19S-associated deubiquitinases UCHL5 and PSMD14 during protein degradation. UCHL5 reversibly associate with the 19S regulatory particle whereas PSMD14 is an intrinsic subunit of the proteasome lid subcomplex.

Belongs to the ADRM1 family.

41.955 kDa

MTTSGALFPSLVPGSRGSSNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGASGSGGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSGGPPASSSSSSSRSQSAAVTPSSTTSSTRATPAPSAPAAASATSPSPAPSSGDGASTAASPAQPIQLSDLQSILATMSVPAGPGGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTAEEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNSASPEQQEGDGKDKKDEEEDMSLD

ADRM1

Proteasomal ubiquitin receptor ADRM1

407 amino acids

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. Within the complex, functions as a proteasomal ubiquitin receptor. Engages and activates 19S-associated deubiquitinases UCHL5 and PSMD14 during protein degradation. UCHL5 reversibly associate with the 19S regulatory particle whereas PSMD14 is an intrinsic subunit of the proteasome lid subcomplex.

Belongs to the ADRM1 family.

42.153 kDa

MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPGSSSSSSSRSQSAAVTPSSTTSSTRATPAPSAPAAASATSPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD

Adrm1

Proteasomal ubiquitin receptor ADRM1

407 amino acids

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. Within the complex, functions as a proteasomal ubiquitin receptor. Engages and thus activates 19S-associated deubiquitinases UCHL5 and PSMD14 during protein degradation. UCHL5 reversibly associate with the 19S regulatory particle whereas PSMD14 is an intrinsic subunit of the proteasome lid subcomplex.

Belongs to the ADRM1 family.

42.06 kDa

MTTSGALFPSLVPGSRGSSTKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLNNPPMPGSLGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPASSSSSSSRSQSAAVTPSSSTSSARATPAPSAPAAASATSPSPAPSSGNGTSTAASPTQPIQLSDLQSILATMNVPAGPGGSQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKSDPKEGDTKDKKDEEEDMSLD

Adrm1

Proteasomal ubiquitin receptor ADRM1

407 amino acids

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. Within the complex, functions as a proteasomal ubiquitin receptor. Engages and thus activates 19S-associated deubiquitinases UCHL5 and PSMD14 during protein degradation. UCHL5 reversibly associate with the 19S regulatory particle whereas PSMD14 is an intrinsic subunit of the proteasome lid subcomplex.

Belongs to the ADRM1 family.

42.102 kDa

MTTSGALFPSLVPGSRGSSTKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLNNPPMPGTLGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPASSSSSSSRSQSAAVTPSSTTSSARATPAPSAPAAASATSPSPAPSSGNGTSTAASPTQPIQLSDLQSILATMNVPAGPGGSQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTAEEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKSDPKEGDTKDKKDEEEDMSLD

ADRM1

Proteasomal ubiquitin receptor ADRM1

406 amino acids

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. Within the complex, functions as a proteasomal ubiquitin receptor. Engages and thus activates 19S-associated deubiquitinases UCHL5 and PSMD14 during protein degradation. UCHL5 reversibly associate with the 19S regulatory particle whereas PSMD14 is an intrinsic subunit of the proteasome lid subcomplex.

Belongs to the ADRM1 family.

42.367 kDa

MTTSGALFPSLVPGSRGSSSKYLVEFRAGKMSLKGSTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCTTGRVYVLKFKAGSKRLFFWMQEPKTDKDEEHCRKVNEYLNNPPMPGALGGNASGGHELSALGGEGGLQSLLGNMSHNQLMQLIGPTGLGGLGGLGALTGPGLASLLGSGGFPTSSSSSSSRSQSAAVTPSSTTSSTHVTPAPAVPAAASVTSPSPVPSSGSGTSSATSPTQPIQLSDLQNILATMNVPSGAGGQQVDLATVLTPEIMAPILANAEVQERLMPYLPSGESLPQTAEEIQNTLTSPQFQQALSMFSAALASGQHGPLMSQFGLPAEAIDAANKGDVEAFAKAMQNSVKSDQKEGDSKDKKDEEEDMSLD

adrm1

Proteasomal ubiquitin receptor ADRM1

404 amino acids

Functions as a proteasomal ubiquitin receptor. Promotes the deubiquitinating activity associated with the 26S proteasome (By similarity).

Belongs to the ADRM1 family.

42.069 kDa

MSSGALFPSLVPGSRGSSSKYLVEFRAGKMSLKGSTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGSVEDDLIIFPDDCEFKRVSQCTTGRVYVLKFKAGSKRLFFWMQEPKTDKDEEYCRKVNEYLNNPPMPGALGGSGSGGHELSALGGEGGLQSLLGNMSHNQLMQLIGPTGLGGLGGLGALTGPGLASLLGSGGPTTSSSSSSSRSQSAAVTPSSTTSSTRTTSAPAAPAAAPATTPSPAVSSNDGASAATSPTQPIQLSDLQNILATMNVPATGEGGQQVDLASVLTPEIMAPILANAEVQERLMPYLPSGESLPQTADEIQNTLTSPQFQQALSMFSAALASGQLGPLMSQFGLPADAVDAANKGDIEAFAKAMQTTSSQKERESSEKKEEEEDMSLD