ADA2

Transcriptional adapter ADA2

567 amino acids

Required for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known. ADA2 and GCN5 function to acetylate nucleosomes, opening up the promoter region (By similarity).

63.552 kDa

MGRSRGVPNSGDDETNHRSKRRRVASSGDAPDSLSAACGGAGEGGGKKALYHCNYCNKDISGKIRIKCSKCPDFDLCVECFSVGAEVTPHRSNHPYRVMDNLSFPLICPDWNADEEILLLEGIEMYGLGNWAEVAEHVGTKTKAQCIDHYTTAYMNSPCYPLPDMSHVNGKNRKELLAMAKVQGESKKVLPGDLTPKDESPFSPPRVKVEDALGEGLAGRSPSHIAGGANKKASNVGQFKDGANVAKVEDGHVDRSIGVKKPRYSADEGPSLTELSGYNSKRHEFDPEYDNDAEQALAEMEFKETDSETDRELKLRVLRIYLSRLDERKRRKEFILERNLLFPNPLEKDLTNEDKEVYHRYKVFMRFLSKEEHEALVRSVLEERKIRRRIQELQECRSAGCRTLAEAKIHIEQKRKKEHEVNAQKAKESGQLLSNTKVVHKTNRPMKIESDGNLDQKKGGASLDSTGRDSPKTTGHAGTKHWDDWDIVGFPGAELLSTSEKNLCCQNRLLPNHYLKMQEVLMQEIFKGSVAKKEDAHVLFKVDPAKVDNVYDMVTKKLGTNEEAPTV

ADA2

Adenosine deaminase 2

543 amino acids

Adenosine deaminase that may contribute to the degradation of extracellular adenosine, a signaling molecule that controls a variety of cellular responses. May play a role in the regulation of cell proliferation (By similarity).

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family. ADGF subfamily.

62.616 kDa

MFLKFKNIFFIVLTLSIVFNGLIVNSKNIHINNKNNNNNNNNKDLSSSESGSSSDINPYISQYNSERETLVNQENQIKLGSNTPFNSKEQQANTIFLNILQNEELSFSNNDPSGVNFFIEKQIIENESTIFKIIQNMPKGSALHVHQDSSATYDYLISVGSYLPNCYIYLTYDVNDANNGTFHFYDSQPTDSNWKLLSTIREGVSNVESFDQQLLDSLTLIGQDYGDYVSLWRKFDGIFGRVNGLVTYLPIATGYMEHLFQQMIQDGVQHIEVRKCFGDFYDLTGKIYDDYWFVQTMEELVLTTRQKYNMSEFALKIIGCNGRHNNQSVVYDAMVMSLDLRNKYPSTFVGYDLVGPEDEGYPLIYFIEQFAEIKKLGYQYQYPLDYYFHAGETILYNNTNLYDAILLNTKRIGHGIQLPKHPLLMDLVLKNDIGIEICPISNQILQYVSDMRAHPGLDLLNRGLPVTISPDDPAIFNYGGLSYDFFELTYSWGLNLQQLKQLAINSINHSNTFNQSEYNLLYNAWEVKWFNFIDYIINTYSNI

ADA2

Adenosine deaminase 2

511 amino acids

Adenosine deaminase that may contribute to the degradation of extracellular adenosine, a signaling molecule that controls a variety of cellular responses. Requires elevated adenosine levels for optimal enzyme activity. Binds to cell surfaces via proteoglycans and may play a role in the regulation of cell proliferation and differentiation, independently of its enzyme activity.

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family. ADGF subfamily.

58.934 kDa

MLVDGPSERPALCFLLLAVAMSFFGSALSIDETRAHLLLKEKMMRLGGRLVLNTKEELANERLMTLKIAEMKEAMRTLIFPPSMHFFQAKHLIERSQVFNILRMMPKGAALHLHDIGIVTMDWLVRNVTYRPHCHICFTPRGIMQFRFAHPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHPEVIYTNQNVVWSKFETIFFTISGLIHYAPVFRDYVFRSMQEFYEDNVLYMEIRARLLPVYELSGEHHDEEWSVKTYQEVAQKFVETHPEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDKFIADVATK

ADA2

Transcriptional adapter 2

445 amino acids

Functions as component of the transcription regulatory histone acetylation (HAT) complexes SAGA, SALSA and ADA. SAGA is involved in RNA polymerase II-dependent transcriptional regulation of approximately 10% of yeast genes. At the promoters, SAGA is required for recruitment of the basal transcription machinery. SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). SALSA, an altered form of SAGA, may be involved in positive transcriptional regulation. ADA preferentially acetylates nucleosomal histones H3 (to form H3K14ac and H3K18ac) and H2B. Required for expression of many CAS5-dependent genes. Plays a key role in cell wall integrity, cell adhesion, hyphal development and pathogenesis.

51.11 kDa

MDSRTKLFHCDVCSSDCTNRIRIQCAICTDYDLCVPCFAAGLTTGDHKPWHDYQIIEQNTYPIFDRDWGADEELLLIQGCETSGLGNWADIADHIGNRSKEEVAEHYFKIYLESKDYPLPEMNKDFTDVSPLQFLEERKERLEKRKNIPLPPPRGKPVASVPLCHEIQGYMPGRLEFDHEAENEAEIPIKDMVFDPEDSANDIDLKLTILDIYNSRLTTRAERKRVMILNHLLDYRKNIGSDKRKSKEEKDLLKKINAFIRILTPEDFESFSRDLLTELKCRMKIQQLQTWRRNGITTLEDGAKFEKDKVIRAAHYQRMGNGTGSGRHSQTPGLTNGNSFNGNGHRNKFSPQPEFRSKSTTARAPLDISHAADFELLSAEEKQLCATLRILPKPYLAIKNQLMREAVKNNGVLKKKDARQALKIDVNKASKIYEFFVHMGWCSQG

ADA2

Adenosine deaminase 2

12 amino acids

Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine. Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events (By similarity).

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family.

1.466 kDa

single

TPLWSLMQDLMM