Function
Nonribosomal peptide synthetase; part of the gene clusters that mediate the biosynthesis of the host-selective toxins (HSTs) ACT-toxins responsible for brown spot of tangerine disease by the tangerine pathotype which affects tangerines and mandarins (PubMed:19271978). ACT-toxins consist of three moieties, 9,10-epoxy-8-hydroxy-9-methyl-decatrienoic acid (EDA), valine and a polyketide (PubMed:22846083). ACT-toxin I is toxic to both citrus and pear; toxin II the 5''-deoxy derivative of ACT-toxin I, is highly toxic to pear and slightly toxic to citrus (PubMed:22846083). On cellular level, ACT-toxins affect plasma membrane of susceptible cells and cause a sudden increase in loss of K(+) after a few minutes of toxin treatment (PubMed:22846083). The acyl-CoA ligase ACTT1, the hydrolase ACTT2, the enoyl-CoA hydratases ACTT3 and ACTT6, and the acyl-CoA synthetase ACTT5 are all involved in the biosynthesis of the AK-, AF- and ACT-toxin common 9,10-epoxy-8-hydroxy-9-methyl-decatrienoic acid (EDA) structural moiety (PubMed:18944496, PubMed:18986255, PubMed:19271978). The exact role of each enzyme, and of additional enzymes identified within the AF-toxin clusters have still to be determined (PubMed:18944496, PubMed:18986255, PubMed:19271978). On the other hand, ACTTS1 to ACTTS4 are specific to the tangerine pathotype (PubMed:22846083). The function of ACTTS3 is to elongate the polyketide chain portion of ACT-toxin that is unique to this toxin (PubMed:20192828). The enoyl-reductase ACTTS2 might complement the missing enoyl-reductase (ER) domain in ACTTS3 in the synthesis of the polyketide portion of ACT-toxin (PubMed:20055645). The roles of the nonribosomal peptide synthetases-related proteins ACTTS1 and ACTTS4 have also still not been elucidated (PubMed:22846083).
Sequence
MSSDSEKGRFSLLGLSEPELSAFIIHKASQANVEVSVIEDVYPCSPMQENIQMSKSRSHDAQYRMVAINHITLPRAGDSIDIHRLRHAWQQVADRHSILRTIFAESFDHGRFCDQIVLEHPDINFHEVSDVNQTPDGISFRQDSPAYLLTIMPLELDERGVVCRIEIDHTIIDGWSYGIMLRDWARAYAGKLREEGPAPQYSDYIAFLQTENHEAHLQYWLNALTGVQPCLVPGTMGLHVKRTQSSRSVPVLNIRSPILQAFCRKLKVTVFNVVQAAWTMVLRKYTGMDDVCFGYVAACRDLPIGNAEEIVGPLINMLVCRTRLDSLQSTSELVQAMQRQMIENGRHQTTSLGAIHHALKMRGLRLFNTAVNFRSFRRDKFQEHGIAIEVFEDRRNMEVSKISLA