ACAT1

Acetyl-CoA acetyltransferase, mitochondrial

427 amino acids

This is one of the enzymes that catalyzes the last step of the mitochondrial beta-oxidation pathway, an aerobic process breaking down fatty acids into acetyl-CoA (PubMed:1715688, PubMed:7728148, PubMed:9744475). Using free coenzyme A/CoA, catalyzes the thiolytic cleavage of medium- to long-chain 3-oxoacyl-CoAs into acetyl-CoA and a fatty acyl-CoA shortened by two carbon atoms (PubMed:1715688, PubMed:7728148, PubMed:9744475). The activity of the enzyme is reversible and it can also catalyze the condensation of two acetyl-CoA molecules into acetoacetyl-CoA (PubMed:17371050). Thereby, it plays a major role in ketone body metabolism (PubMed:17371050, PubMed:1715688, PubMed:7728148, PubMed:9744475).

Belongs to the thiolase-like superfamily. Thiolase family.

45.2 kDa

MAVLAALLRSGARSRSPLLRRLVQEIRYVERSYVSKPTLKEVVIVSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLVVLANIKMLEIDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGASAMLIQKL

ACAT1

Acetyl-CoA acetyltransferase, mitochondrial

427 amino acids

This is one of the enzymes that catalyzes the last step of the mitochondrial beta-oxidation pathway, an aerobic process breaking down fatty acids into acetyl-CoA. Using free coenzyme A/CoA, catalyzes the thiolytic cleavage of medium- to long-chain 3-oxoacyl-CoAs into acetyl-CoA and a fatty acyl-CoA shortened by two carbon atoms. The activity of the enzyme is reversible and it can also catalyze the condensation of two acetyl-CoA molecules into acetoacetyl-CoA. Thereby, it plays a major role in ketone body metabolism.

Belongs to the thiolase-like superfamily. Thiolase family.

45.2 kDa

MAVLAALLRGGARSRSPLLRRLVQEIRYVERSYVSKPTLKEVVIVSATRTPIGSFLGSLSLLPTTKLGSIAMQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPARQAVLGAGLPISTPRTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARDEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTITAANASTLNDGAAALVLMTAGAAKRLNVTPLARIVAFADAAVEPIDFPIAPVHAVSMVLKDVGLKKEDIAMWEVNEAFSLVVLANIKMLEIDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGASAMLIQKL

Acat1

Acetyl-CoA acetyltransferase, mitochondrial

424 amino acids

This is one of the enzymes that catalyzes the last step of the mitochondrial beta-oxidation pathway, an aerobic process breaking down fatty acids into acetyl-CoA. Using free coenzyme A/CoA, catalyzes the thiolytic cleavage of medium- to long-chain 3-oxoacyl-CoAs into acetyl-CoA and a fatty acyl-CoA shortened by two carbon atoms. The activity of the enzyme is reversible and it can also catalyze the condensation of two acetyl-CoA molecules into acetoacetyl-CoA. Thereby, it plays a major role in ketone body metabolism.

Belongs to the thiolase-like superfamily. Thiolase family.

44.816 kDa

MAALVALHGVVRRPLLRGLLQEVRCLERSYASKPTLNEVVIVSAIRTPIGSFLGSLASQPATKLGTAAIQGAIEKAGIPKEEVKEVYMGNVIQGGEGQAPTRQATLGAGLPISTPCTTVNKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMSRGATPYGGVKLEDLIVKDGLTDVYNKIHMGNCAENTAKKMNISRQEQDTYALSSYTRSKEAWDAGKFASEITPITISVKGKPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTITAANASTLNDGAAALVLMTAEAAQRLNVKPLARIAAFADAAVDPIDFPLAPAYAVPKVLKYAGLKKEDIAMWEVNEAFSVVVLANIKMLEIDPQKVNIHGGAVSLGHPIGMSGARIVVHMAHALKPGEFGLASICNGGGGASALLIEKL

Acat1

Acetyl-CoA acetyltransferase, mitochondrial

424 amino acids

This is one of the enzymes that catalyzes the last step of the mitochondrial beta-oxidation pathway, an aerobic process breaking down fatty acids into acetyl-CoA. Using free coenzyme A/CoA, catalyzes the thiolytic cleavage of medium- to long-chain 3-oxoacyl-CoAs into acetyl-CoA and a fatty acyl-CoA shortened by two carbon atoms. The activity of the enzyme is reversible and it can also catalyze the condensation of two acetyl-CoA molecules into acetoacetyl-CoA. Thereby, it plays a major role in ketone body metabolism.

Belongs to the thiolase-like superfamily. Thiolase family.

44.695 kDa

MAALAVLHGVVRRPLLRGLLQEVRCLGRSYASKPTLNDVVIVSATRTPIGSFLGSLASQPATKLGTIAIQGAIEKAGIPKEEVKEVYMGNVIQGGEGQAPTRQATLGAGLPIATPCTTVNKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMSRGATPYGGVKLEDLIVKDGLTDVYNKIHMGNCAENTAKKLSISREEQDKYAIGSYTRSKEAWDAGKFANEITPITISVKGKPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAAVVLMTAEAAQRLKVKPLARIAAFADAAVDPIDFPLAPAYAVPKVLKYAGLKKEDIAMWEVNEAFSVVVLANIKMLEIDPQKVNVHGGAVSLGHPIGMSGARIVVHLAHALKQGEFGLASICNGGGGASAVLIEKL

ACAT1

Acetyl-CoA acetyltransferase, mitochondrial

422 amino acids

This is one of the enzymes that catalyzes the last step of the mitochondrial beta-oxidation pathway, an aerobic process breaking down fatty acids into acetyl-CoA. Using free coenzyme A/CoA, catalyzes the thiolytic cleavage of medium- to long-chain 3-oxoacyl-CoAs into acetyl-CoA and a fatty acyl-CoA shortened by two carbon atoms. The activity of the enzyme is reversible and it can also catalyze the condensation of two acetyl-CoA molecules into acetoacetyl-CoA. Thereby, it plays a major role in ketone body metabolism.

Belongs to the thiolase-like superfamily. Thiolase family.

44.889 kDa

MPVLAALLRRGPLLQRRVQEIRYAERSYVSKPTLNEVVIVSAIRTPIGSFLGSLSSLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQNLMCGHQDVMVAGGMESMSNVPYVMNRGATPYGGVKLEDLIVKDGLTDVYNKIHMGNCAENTAKKLNITREEQDTYALNSYTRSKAAWEAGRFGNEVVPVTITVKGKPDVVVKEDEEYKRVDFSKIPKLKTVFQRENGTVTAANASTLNDGAAAVVLMTADAAKRLNVKPLARIAAFADAAVEPIDFPLAPAYAVPKVLKDAGLKKEDITMWEVNEAFSVVVLANIKMLEMDPQKVNINGGAVSLGHPIGMSGARIVVHLAHALKQGEYGLASICNGGGGASAMLIQKL

acat1

Acetyl-CoA acetyltransferase, mitochondrial

420 amino acids

This is one of the enzymes that catalyzes the last step of the mitochondrial beta-oxidation pathway, an aerobic process breaking down fatty acids into acetyl-CoA. Using free coenzyme A/CoA, catalyzes the thiolytic cleavage of medium- to long-chain 3-oxoacyl-CoAs into acetyl-CoA and a fatty acyl-CoA shortened by two carbon atoms. The activity of the enzyme is reversible and it can also catalyze the condensation of two acetyl-CoA molecules into acetoacetyl-CoA. Thereby, it plays a major role in ketone body metabolism.

Belongs to the thiolase-like superfamily. Thiolase family.

44.03 kDa

MAFCGPRTAARLSHSTRALHYTHRGHVSQRTLNEVVIASAARTPIGSFQGSLSSLPATKLGSIAIKAAVERAGIPGDEVKEVYMGNVLQAGQGQAPSRQATLGAGLAISTPTTTINKVCASGMKSIMLAAQSLMCGHQQVMVAGGMESMSNVPYCMSRGATPYGGVKLEDIIVKDGLTDVYNKFHMGNCAENTAKKLSISREEQDSFAINSYTRSKAAWDSGLIANEIVSVTISQKGRPDIIVQEDEEYKRVDFSKFSKLKTVFQKDNGTVTAANASTLNDGAAALVLMTAGAASRLNVTPLARIVAFADAAVDPIDFPIAPAYAVPKLLSEAGLKKEDIAMWEINEAFSVVVLANVKMLDIDPARVNVNGGAVSLGHPIGMSGARIVGHMAHVLKKGQFGIAGICNGGGGASAVLIEKL

acat1

Acetyl-CoA acetyltransferase, mitochondrial

420 amino acids

This is one of the enzymes that catalyzes the last step of the mitochondrial beta-oxidation pathway, an aerobic process breaking down fatty acids into acetyl-CoA. Using free coenzyme A/CoA, catalyzes the thiolytic cleavage of medium- to long-chain 3-oxoacyl-CoAs into acetyl-CoA and a fatty acyl-CoA shortened by two carbon atoms. The activity of the enzyme is reversible and it can also catalyze the condensation of two acetyl-CoA molecules into acetoacetyl-CoA. Thereby, it plays a major role in ketone body metabolism.

Belongs to the thiolase-like superfamily. Thiolase family.

44.342 kDa

MTSRALYSTRSQLCRHLAHKYLSRSYSTRPSLNEVVIVSAVRTPIGSFKGSLSTLPATKLGSIAIKGAIDKAGIPVEEVKEVYMGNVLQAGEGQAPTRQALLGAGLPLSTPATTINKVCASGMKSIMLASQSLMCGHQDVMVAGGMESMSQVPYIMAREAPPYGGVKMEDLIVKDGLTDVYNKFHMGNCAENTAKNSSISREEQDAFAIKSYTLSKAAWESGILAKEVVPVSIPQRGKPDVVVKEDEEYRKVDFSKVPKLKAVFLKENGTVTAANASTLNDGAAALVLMTADAAQRLNVTPLAKIVAFADAAVAPIDFPIAPAFAVPKVLKAAGIKKEDIAMWEINEAFSVVVLANIKMLDIDPDRVNINGGAVSLGHPIGMSGARIVGHMVHNLKSGQYGLAGICNGGGGASSIVIQKF