AC1

Actin-1

377 amino acids

Essential component of cell cytoskeleton; plays an important role in cytoplasmic streaming, cell shape determination, cell division, organelle movement and extension growth.

Belongs to the actin family.

41.863 kDa

MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDMKEKLAYIALDYDQEMETAKTSSSVEKSYELPDGQVITIAADRFRCPEVLFQPSFIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMRQGNHCLAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF

AC1

Replication-associated protein

361 amino acids

Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities.

Belongs to the geminiviridae Rep protein family.

40.677 kDa

MPRLGRFAINAKNYFLTYPRCPLTKEDVLEQLLALSTPVNKKFIRVCRELHEDGEPHLHVLLQFEGKLQTKNERFFDLVSPTRSTHYHPNIQAAKSASDVKSYMDKDGDVLDHGSFQVDGRSARGGKQSANDAYAEALNSGSKLQALNILREKAPKDYILQFHNLNCNLSRIFADDVPPYVSPYSLSAFDKVPSYISSWASENVRDSCAPERPISIVIEGDSRTGKTMWARALGPHNYLCGHLDLNSKIYSNDAWYNVIDDVDPHYLKHFKEFMGAQRDWQSNVKYGKPTHIKGGIPTIFLCNPGPKSSYKEYLDEPDNTALKLWASKNAEFYTLKEPLFSSVDQGATQGCQEASNSTLSN

AC1

Replication-associated protein

361 amino acids

Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities (By similarity).

Belongs to the geminiviridae Rep protein family.

40.85 kDa

MPRKGSFSIKAKNYFLTYPQCSISKEEALSQLQNLTIPVNKKFIKICRELHENGEPHLHVLIQFEGKYNCTNNRLFDLVSPTRSTHFHPNIQGAKSSSDVKSYVEKDGDTIEWGLFQIDGRSARGGQQTVNDAAAEALNSGTKEAAMKIIKEKLPEKFLFQYHNLSCNLDRIFMKAPETWAPPFPLSSFTNVPDEMQEWADGYFGKSSAARPERPISIIIEGDSRRGKTMWARVLGPHNYLSGHLDFNPRVYSNEVEYNVIDDVAPQYLKLKHWKELLGAQRDWQSNCKYGKPVQIKGGIPSIVLCNPGEGSSYKAFLDKDENASLKNWTLKNAVFITITAPLYQEGTQASKEEGNQEETH

AC1

Replication-associated protein

361 amino acids

Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities (By similarity).

Belongs to the geminiviridae Rep protein family.

40.516 kDa

MPPPKKFRVQSKNYFLTYPQCSLSKEEALSQLQNLNTPVNKKFIKICRELHENGEPHLHVLVQFEGKYQCTNNRFFDLVSPTRSAHFHPNIQGAKSSSDVKSYIDKDGDTIEWGDFQIDGRSARGGQQSANDSYAKALNAGSVQSALAVLREEQPKDFVLQNHNIRSNLERIFAKAPEPWVPPFQVSSFTNVPDEMQEWADNYFGTGDAAPPDRPVSIIVEGDSRTGKTMWARALGPHNYLSGHLDFNGRVFSNDVQYNVIDDIAPHYLKLKHWKELLGAQKDWQSNCKYGKPVQIKGGIPAIVLCNPGEGASYKEFLDKAENTGLKNWTIKNAIFITLTAPLYQESTQASQETGNQKAQG

AC1

Replication-associated protein

358 amino acids

Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities (By similarity).

Belongs to the geminiviridae Rep protein family.

40.346 kDa

MRTPRFRIQAKNVFLTYPKCSIPKEHLLSFIQTLSLQSNPKFIKICRELHQNGEPHLHALIQFEGKITITNNRLFDCVHPSCSTSFHPNIQGAKSSSDVKSYLDKDGDTVEWGQFQIDGRSARGGQQSANDAYAKALNSGSKSEALNVIRELVPKDFVLQFHNLNSNLDRIFQEPPAPYVSPFPCSSFDQVPVEIEEWVADNVRDSAARPWRPNSIVIEGDSRTGKTIWARSLGPHNYLCGHLDLSPKVFNNAAWYNVIDDVDPHYLKHFKEFMGSQRDWQSNTKYGKPVQIKGGIPTIFLCNPGPTSSYKEFLAEEKQEALKAWALKNAIFITLTEPLYSGSNQSHSQTSQEASHPA

AC1

Replication-associated protein

358 amino acids

Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities (By similarity).

Belongs to the geminiviridae Rep protein family.

40.435 kDa

MRTPRFRVQAKNVFLTYPNCSIPKEHLLSFIQTLSLPSNPKFIKICRELHQNGEPHLHALIQFEGKITITNNRLFDCVHPSCSTNFHPNIQGAKSSSDVKSYLDKDGDTVEWGQFQIDGRSARGGQQSANDAYAKALNSGSKSEALNVIRELVPKDFVLQFHNLNSNLDRIFQEPPAPYVSPFPCSSFDQVPDELEEWVADNVRDSAARPWRPNSIVIEGDSRTGKTIWARSLGPHNYLCGHLDLSPKVFNNDAWYNVIDDVDPHYLKHFKEFMGSQRDWQSNTKYGKPVQIKGGIPTIFLCNPGPTSSYKEFLDEEKQEALKAWALKNAIFITLTEPLYSGSNQSQSQTIQEASHPA

AC1

Replication-associated protein

356 amino acids

Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities (By similarity).

Belongs to the geminiviridae Rep protein family.

40.247 kDa

MPPPKKFRVQAKNYFLTYPQCSLTKDEALSQLQNLETPVNKKFIKICRELHENGEPHLHVLIQFEGKYQCTNNRFFDLVSPTRSAHFHPNIQGAKSSSDVKSYIDKDGDTAEWGEFQIDGRSARGGQQTANDSYAKALNAGDVQSALNILKEEQPKDYVLQNHNIRSNLERIFAKAPEPWVPRFPLSSFTAVPEEMQEWADDYFGSGSAARPDRPLSLIVEGDSRTGKTMWARALGPHNYLSGHLDFNGRVYSNEVEYNVIDDVAPHYLKLKHWKELLGAQKDWQSNCKYGKPVQIKGGIPAIVLCNPGEGSSYKEYLDKEENTGLRNWTLKNAIFITLTAPLYQEGTQAGQEEGH

AC1

Replication-associated protein

353 amino acids

Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities.

Belongs to the geminiviridae Rep protein family.

40.228 kDa

MPPPQRFRVQSKNYFLTYPRCTIPKEEALSQLQKIHTTTNKKFIKVCEERHDNGEPHLHALIQFEGKFICTNKRLFDLVSTTRSAHFHPNIQGAKSSSDVKEYIDKDGVTIEWGQFQVDGRSARGGQQSANDSYAKALNADSIESALTILKEEQPKDYVLQNHNIRSNLERIFFKVPEPWVPPFPLSSFVNIPVVMQDWVDDYFGRGSAARPERPISIIVEGDSRTGKTMWARALGPHNYLSGHLDFNSRVYSNSVEYNVIDDISPNYLKLKHWKELIGAQKDWQSNCKYGKPVQIKGGIPSIVLCNPGEGSSYKDFLNKEENRALHNWTIHNAIFVTLTAPLYQSTAQDCQT

AC1

Replication-associated protein

353 amino acids

Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities (By similarity).

Belongs to the geminiviridae Rep protein family.

40.19 kDa

MPPPQRFRVQSKNYFLTYPRCTIPKEEALSQLQKIHTTTNKKFIKVCEERHDNGEPHLHALIQFEGKFICTNKRLFDLVSTTRSAHFHPNIQGAKSSSDVKEYIDKDGVTIEWGQFQVDGRSARGGQQSANDSYAKALNADSIESALTILKEEQPKDYVLQNHNIRSNLERIFFKVPEPWVPPFPLSSFVNIPVVMQDWVDDYFGRGSAARPERPISIIVEGDSRTGKTMWARALGPHNYLSGHLDFNSLVYSNSVEYNVIDDITPNYLKLKDWKELIGEQKDWQSNCKYGKPVQIKGGIPSIVLCNPGEGSSYKDFLNKEEKPALHNWTIHNAIFVTLTAPLYQSTAQDCQT

AC1

Replication-associated protein

352 amino acids

Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities (By similarity).

Belongs to the geminiviridae Rep protein family.

40.332 kDa

MPSHPKRFQINAKNYFLTYPQCSLSKEESLSQLQALNTPINKKFIKICRELHEDGQPHLHVLIQFEGKYCCQNQRFFDLVSPTRSAHFHPNIQRAKSSSDVKTYIDKDGDTLVWGEFQVDGRSARGGCQTSNDAAAEALNASSKEEALQIIREKIPEKYLFQFHNLNSNLDRIFDKTPEPWLPPFHVSSFTNVPDEMRQWAENYFGKSSAARPERPISIIIEGDSRTGKTMWARSLGPHNYLSGHLDLNSRVYSNKVEYNVIDDVTPQYLKLKHWKELIGAQRDWQTNCKYGKPVQIKGGIPSIVLCNPGEGASYKVFLDKEENTPLKNWTFHNAKFVFLNSPLYQSSTQSS

AC1

Replication-associated protein

351 amino acids

Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities (By similarity).

Belongs to the geminiviridae Rep protein family.

40.058 kDa

MSPPKRFQINAKNYFLTYPRCSLTKEEALSQIRNFQTPTNPKFIKICRELHENGEPHLHVLIQFEGKYKCQNQRFFDLVSPTRSAHFHPNIQGAKSSSDVKSYIDKDGDTWRWGTFQIDGRSARGGQQSANDAYAAALNSGSKSEALKILRELAPRDYLRDFHHISSNLDRIFTKPPPPYENPFPLSSFDRVPEELDEWFHENVMGRARPLRPKSIVIEGDSRTGKTMWSRALGPHNYLCGHLDLSPKVYNNDAWYNVIDDVDPHYLKHFKRIHGGPEDWQSNTKYGKPVQIKGGIPTIFLCNPGPNSSYKEFLDEEKNSALKAWALKNATFISLEGPLYSGTNQGPTQSC

AC1

Replication-associated protein

349 amino acids

Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities (By similarity).

Belongs to the geminiviridae Rep protein family.

39.722 kDa

MPLPKRFRLNAKNYFLTYPQCSISKEERLAQLQNLSTPVNKKYIKICKESHEDGQPHLHVLIQFEGKYQCTNNRFFDLVSSTRSAHFHPNIQGAKSSSDVKTYIDKDGDTVEWGEFQIDGRSARGGQQSANDTYAKALNSASAEEALQIIKEEQPQHFFLQFHNIVSNANRIFQTPPEPWVPPFQQASFNNVPAIMTQWVSDNVCDAAARPMRPLSLVVEGPSRTGKTLWARSLGPHNYICGHMDLSPKIYSNNAWYNVIDDIPPHYVKHFKEFMGAQRDWQSNCKYGKPIQIKGGIPTIFLCNPGPQSSYKDYLSEEKNRSLNDWVQKNAIYVTIEEAIFTTGSQTSP

AC1

Replication-associated protein

349 amino acids

Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities (By similarity).

Belongs to the geminiviridae Rep protein family.

39.231 kDa

MPRNPKSFRLAARNIFLTYPQCDIPKDEALQMLQTLSWSVVKPTYIRVAREEHSDGFPHLHCLIQLSGKSNIKDARFFDITHPRRSANFHPNIQAAKDTNAVKNYITKDGDYCESGQYKVSGGTKANKDDVYHNAVNAGCVEEALAIIRAGDPKTFIVSYHNVRANIERLFTKAPEPWAPPFQLSSFTNVPDEMSSWADDYFGRSAAARAERPISIIVEGDSRTGKTMWARALGPHNYLSGHLDFNSKVFSNNAEYNVIDDIAPHYLKLKHWKELIGAQRDWQSNCKYGKPVQIKGGIPSIVLCNPGEGSSYISFLNKEENASLRAWTTKNAKFITLEAPLYQSTAQDC

AC1

Replication-associated protein

347 amino acids

Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities (By similarity).

Belongs to the geminiviridae Rep protein family.

39.11 kDa

MPRNPNSFRLTARNIFLTYPRCDVPKEEVLEMLLHLSWSVVKPNYVRVAREEHSDGSPHLHCLIQLSGKSNIKDAGFFDLTHPRRSARFHPNIQAAKDTNAVKNYITKEGDYCESGQYKVSGGSKSNKDDVYHNAVNAGSAGEALDIIKAGDPKTFIVNYHNLLANVERLFQKPPEPWVPPFELSSFTSVPEELQDWADDYFNECSAAARPTSIIIEGGSRTGKTMWARSLGPHNYLSGHLDFNSRVFSNDVKYNVIDDVAPHYLKLKHWKELIGAQRDWQSNCKYGKPVQIKGGIPSIVLCNPGEGSSYKDFLDKAENSALREWTEKNAKFIFLEGPLYQSTAQDC