ABA4

Protein ABA DEFICIENT 4, chloroplastic

220 amino acids

Required for neoxanthin biosynthesis, an intermediary step in abscisic acid (ABA) biosynthesis. Probably not involved directly in the enzymatic conversion of violaxanthin to neoxanthin. Cannot convert violaxanthin to neoxanthin in vitro. Required for ABA biosynthesis in response to drought stress (PubMed:17470058). Required for neoxanthin biosynthesis which is involved in photoprotection of photosystem II (PSII). Neoxanthin acts as an antioxidant within the photosystem PSII supercomplex (PubMed:17351115).

24.624 kDa

MGFSSFISQPLSSSLSVMKRNVSAKRSELCLDSSKIRLDHRWSFIGGSRISVQSNSYTVVHKKFSGVRASWLTTTQIASSVFAVGTTAVLPFYTLMVVAPKAEITKKCMESSVPYIILGVLYVYLLYISWTPETLKYMFSSKYMLPELSGIAKMFSSEMTLASAWIHLLVVDLFAARQVYNDGLENQIETRHSVSLCLLFCPVGIVSHFVTKAIINNQYK