14-3-3zeta

14-3-3 protein zeta

248 amino acids

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner (By similarity).

Belongs to the 14-3-3 family.

28.228 kDa

MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTESSARKQQLAREYRERVEKELREICYEVLGLLDKFLIPKASNPESKVFYLKMKGDYYRYLAEVATGETRNTVVDDSQAAYQDAFEISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN

14-3-3zeta

14-3-3 protein zeta

248 amino acids

Required in Raf-dependent cell proliferation and photoreceptor differentiation during eye development (PubMed:9159395). Acts upstream of Raf and downstream of Ras, and is essential for viability (PubMed:9159395). Acts as a negative regulator of the slo calcium channel via its interaction with slo-binding protein slob (PubMed:10230800). Inhibits yki activity by restricting its nuclear localization (PubMed:19900439). Binds to and promotes the activity of phosphoinositide 3-kinase Pi3K68D which converts phosphatidylinositol to phosphatidylinositol-3-phosphate and promotes maturation of early endosomes (PubMed:27015288).

Belongs to the 14-3-3 family.

28.228 kDa

MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN

14-3-3zeta

14-3-3 protein zeta

247 amino acids

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner (By similarity).

Belongs to the 14-3-3 family.

28.097 kDa

MSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKVFYLKMKGDYYRYLAEVATGETRHSVVEDSQKAYQDAFEISKAKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPAEGGDN