Catalyzes the formation of N(4)-acetylcytidine (ac(4)C) at the wobble position of elongator tRNA(Met), using acetate and ATP as substrates. First activates an acetate ion to form acetyladenylate (Ac-AMP) and then transfers the acetyl group to tRNA to form ac(4)C34.

Belongs to the TmcAL family.

379 amino acids

MTKITGIIAEFNPFHKGHEYLLNQIDGLKIVAMSGNWMQRGEPAIFDKWTRAEMALSCGADLVVELPVMVSVQAADFFASGAVDILKNLGITDLAFGSESAIDYNEIADIYETKETEMESFIKALPDQLSYPEKTQMMWQHFTGIKFDGNTPNHVLALAYAKAAAGKNINLQAIKRVGKFHSTKLTEGFASATALRQQLFSLTDEVGQSLFSLTDLSAIENHVPSVILETYASPKTNWAAYFPLLQYKIRLDDHLENIFQVNQELSVRLKNAIKSAKNFDELVELVYTKRYTKARVRRLLTYILLNIPKEFNLPKEIHILGFSKAGQEILAQNRGKIISKIGQKPWDELTQKADEIYQLGNVDFKEQNFGRKPIIKREK

42.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tmcAL using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here