Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates mRNA stability (By similarity). M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in mRNA stability and processing (By similarity).

428 amino acids

MAGAASSDRLVTSFPLLDTADLFQDLSLGSDANEVPMNFTKGSFQHPYGHAPYGASSHGSERRPNMNAGNLLNGGDSIGSYPWGYIPANYPSGGYPDPRFGYDRNSNHSSFSHLMNPHSSQEVPSFDQLGYNDHLYSNHGLYGLYGNVIDSGHAYGTFGYDSWKLGRGWYPVDGYRKTRSFNHGRGYSDEKADRLNELCRGPRSSDFKNPQVLNSSMLDAMKQDVSAVDLQRYNGENFPESFVKAKFFVIKSYSEDDVHNCIKYGAWSSTPTGNKKLNAAYYEAKENSQECPVYLLFSVNASGQFVGLAEMVGPVDFNKTMEYWQQDKWIGCFPVKWHIIKDIPNSLLRHITLANNENKPVTNSRDTQEVNLEHGTKIIKIFKEYMSKTCILDDYKFYETRQKIIRDKKIKQKKQALDGASGETINLS

48.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ECT1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here