The Vlp and Vsp proteins are antigenically distinct proteins, only one vlp or vsp gene is transcriptionally active at any one time. Switching between these genes is a mechanism of host immune response evasion.

Belongs to the variable large protein (Vlp) family. Alpha subfamily.

364 amino acids

MRKRISAIINKLNISIMMMIVVLMIGCGQQPEAGKTGAAGGEKQGAGSLSEVLMEVGKSAENAFYSFLELVSDTLGFTAKSTTKKEDVGGYFNSLGGKLGEASNELEQVAKNSEAGIEKNDASKNPIRSAVNAAKKTLEALKGYLDSLGTVGDSNPVGWASNNAQGAAVDEAELKKAYKALKGIMDTAEGAGVARPEVGNIAVKVGNGTDNKDGAKILATDGAAAVGDAGKAAAILTTVSGKEMLASIVNSTEDKAVKITGNVTVETTPLEFAVGGNGAHLSQNANSKAAAVAGGIALRSLVKGGKLAADNNDDDKASQGVGITAANKLLVAVEDIIKKTVKNVLEKAKGEIDKARDPKPAGQQ

37.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make vlp21 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here