Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.

Belongs to the uracil-DNA glycosylase (UDG) superfamily. UNG family.

217 amino acids

MEHSTWHRKIKESLPPDYFARINQFLDQVYSQGRVYPKREHIFKALTETPYEDLKVLILGQDPYHGPGQAQGLSFSVPDSIAAPPSLQNILKELSEDIGKRDHHDLTSWAKQGVLLLNACLTVPEHQANAHAGLIWEPFTDAVIQLANAKESPVVFILWGGFARKKKAFITNPKHLVIESAHPSPLSAYRGFFGSRPFSKCNAFLKENQLEPIDWLQ

24.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ung using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here