Eca and bai are essential, though not redundant, for dorsoventral patterning of the embryo. Specifically required during early embryogenesis for the activity of maternal tkv, while the zygotic tkv is not affected (By similarity).

Belongs to the EMP24/GP25L family.

206 amino acids

MARAALIVCLLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEYEVSDVPGQIIDYIARDTKGHILSQKEHITKGKFSFMSEVYDAYEICFISKVPAHQRGIVQEVSLLTKKGVETKSYEGIGEASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLLGLATWQVLYLRRYFKAKKLIE

23.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make bai using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here