Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Can antagonize antiapoptotic activity of th by directly inducing the degradation of th (By similarity).

Belongs to the peptidase S1C family.

427 amino acids

MALRCINNLEIFLRRCTAPTLHRCCVASSRTAHTASSSKGSGGDNSKDKENNGQNKSGYRSFGWRSAFQFCVPFSLGALVSAVLIERHRDELTPTISARSLKGRRNEFNFIADVVAGCGDSVVYIEIKDTRHFDYFSGQPITASNGSGFVIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVSGLPVMKLGKSSTLRSGEWVVALGSPLALSNTVTAGVISATQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAERRKKGSAHKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPNNLMHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALAEGRKDLEIVILRGVKQMHVKITPEDP

46.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make HtrA2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here