Description
Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Can antagonize antiapoptotic activity of th by directly inducing the degradation of th (By similarity).
Family
Belongs to the peptidase S1C family.
Species
Drosophila pseudoobscura pseudoobscura
Sequence
MALRCINNLEIFLRRCTAPTLHRCCVASSRTAHTASSSKGSGGDNSKDKENNGQNKSGYRSFGWRSAFQFCVPFSLGALVSAVLIERHRDELTPTISARSLKGRRNEFNFIADVVAGCGDSVVYIEIKDTRHFDYFSGQPITASNGSGFVIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVSGLPVMKLGKSSTLRSGEWVVALGSPLALSNTVTAGVISATQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAERRKKGSAHKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPNNLMHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALAEGRKDLEIVILRGVKQMHVKITPEDP
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service