The heterodimer acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2 (By similarity).

Belongs to the ubiquitin-activating E1 family.

350 amino acids

MVEKEEAGGGGGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLIVGMKGLGAEIAKNLILAGVKGLTMLDHEQVSPEDPGAQFLIQTGSVGRNRAEASLERAQNLNPMVDVKVDTEDVEKKPESFFTKFDAVCLTCCSRDVIIKVDQICHRNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPEAKRAKLDSSETTMVKKKVLFCPVKEALEVDWSGEKAKAALKRTAPDYFLLQVLLKFRTDKGRDPTSESYKEDAELLLQIRNDVFDSLGISPDLLPDDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGSGIVECLGPQ

38.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Sae1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here