Description
During stationary phase, prevents 70S dimer formation, probably in order to regulate translation efficiency during transition between the exponential and the stationary phases. In addition, during environmental stress such as cold shock or excessive cell density at stationary phase, stabilizes the 70S ribosome against dissociation, inhibits translation initiation and increase translation accuracy. When normal growth conditions are restored, is quickly released from the ribosome (By similarity).
Family
Belongs to the HPF/YfiA ribosome-associated protein family. YfiA subfamily.
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Sequence
MTLNITSKQMDITPAIREHLEERLAKLGKWQTQLISPHFVLNKVPNGFSVEASIGTPLGNLLASATSDDMYKAINEVEEKLERQLNKLQHKSESRRADERLKDSFEN
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service