Description
S-adenosyl-L-methionine-dependent pseudouridine N(1)-methyltransferase that methylates the pseudouridine corresponding to position 1189 (Psi1189) in S.cerevisiae 18S rRNA. Involved the biosynthesis of the hypermodified N1-methyl-N3-(3-amino-3-carboxypropyl) pseudouridine (m1acp3-Psi) conserved in eukaryotic 18S rRNA. Has also an essential role in 40S ribosomal subunit biogenesis independent on its methyltransferase activity, facilitating the incorporation of ribosomal protein S19 during the formation of pre-ribosomes (By similarity). Essential for cell growth. It also has a key role in promoting the mating function (PubMed:9133664).
Family
Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase NEP1 family.
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Sequence
MPTYSKRKSRGSLEVSEKTNQPKFIKRSQSSETITSGETASELMQDEKEQSNGAVGSIEDEELQRLRENQASVEALSKKPESIDRELGVEALEIDNVVKSDEEKEDPNGASSKTVKARPLPAGSVHRVTTHMAPIPARSIGSHDTTTQRLIVVLDQACLEIYKVGKAKDAKYQLLNCDDHQGILKKLNRNIAQARPDITHQCLLTLLDSPLNKAGRLQVYIHTAKKVLIEVNPSVRIPRTFKRFSGLMVQLLHKLSIRSVNGNEKLLKVIKNPVTDYLPPNCRKATLSFDAPTVPPRKYLETLQPNQSVCIAIGAMAHGPDDFSDGWVDEKISISDYPLSASIACSKFLHSMEDFLGIV
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service