Involved in cell shape and neuronal morphogenesis, positively regulating the establishment and maintenance of dendritic spines. Plays a role in cellular protein transport, including protein transport away from primary cilia. May function via activation of RAC1 and PAK1.

Belongs to the RILPL family.

197 amino acids

MEDHPVREEEDGEEDEGALAKSPLQLTTDDVYDISYVVGRELMALGSDPRVTRLQFKIVRVMEMLETLVNEGSLAVEELRMERDNLKQEVEGLRKAGVSGAQVNLGPDKMVVDLTDPNRPRFTLQELREVLQERNKLKSQLLLVQEELQCYRSGLLPPRETPGGRREKDAVVAMGNGEKEERTIMKKLFSFRSGKHT

22.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Rilpl2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here