Bifunctional serine/threonine kinase and phosphorylase involved in the regulation of the phosphoenolpyruvate synthase (PEPS) by catalyzing its phosphorylation/dephosphorylation.

Belongs to the pyruvate, phosphate/water dikinase regulatory protein family. PSRP subfamily.

273 amino acids

MSTIRPVFYVSDGTGITAETIGHSLLTQFSGFNFVTDRMSFIDDADKARDAAMRVRAAGERYQVRPVVVNSCVDPQLSMILAESGALMLDVFAPFIEPLERELNAPRHSRVGRAHGMVDFETYHRRINAMNFALSHDDGIALNYDEADVILVAVSRAGKTPTCIYLALHYGIRAANYPLTDEDLENEQLPPRLRNYRSKLFGLTIDPERLQQIRQERRANSRYSAAETCRREVAIAERMFQMERIPSLSTTNTSIEEISSKVLSTLGLQREMF

30.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make XAC2042 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here