Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability (By similarity).

Belongs to the insect chemoreceptor superfamily. Heteromeric odorant receptor channel (TC 1.A.69) family. Or2a subfamily.

378 amino acids

MDYDRIRPVRFLTGVLKWWRLWPRKESVSTPDWTNWQAYALHVPFTFLFVLLLWLEAIKSRDIQHTADVLLICLTTTALGGKVINIWKYAHVAQGILSEWSTWDLFELRSKQEVDMWRFEHRRFNRVFMFYCLCSAGVIPFIVIQPLFDIPNRLPFWMWTPFDWQQPVLFWYAFIYQATTIPIACACNVTMDAVNWYLMLHLSLCLRMLGQRLSKLQHDDKDLREKFLELIHLHQRLKQQALSIEIFISKSTFTQILVSSLIICFTIYSMQMSPVLQDLPGFAAMMQYLVAMIMQVMLPTIYGNAVIDSANMLTDSMYNSDWPDMNCRMRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQAYSLLALLLNMNQ

44.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Or71a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here