About Products Protein Database Contact

Protein expression services for vpr | Protein Vpr

Description
Stimulates gene expression driven by the HIV-2 LTR. Prevents infected cells from undergoing mitosis and proliferating, by inducing arrest or delay in the G2 phase of the cell cycle. Cell cycle arrest creates a favorable environment for maximizing viral expression and production (By similarity).
Species
Human immunodeficiency virus type 2 subtype A (isolate SBLISY)
Length
105 amino acids
Sequence
MTEAPAEFPPEDGTPPREPGDEWVIEILREIKEEALKHFDPRLLTALGYYIYTRHGDTLEGARELIRVLQRALFTHFRAGCGHSRIGQPRGRNPLSAIPTPRNMQ
Mass
12 kDa
Simulated SDS-PAGE
Western blot of vpr recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make vpr using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here