Stimulates gene expression driven by the HIV-2 LTR. Prevents infected cells from undergoing mitosis and proliferating, by inducing arrest or delay in the G2 phase of the cell cycle. Cell cycle arrest creates a favorable environment for maximizing viral expression and production (By similarity).

101 amino acids

MAEAAPEIPPENENPQREPWEEWIGEILEEIKQEALKHFDPRLLTALGNFIYSRHGDTLAGAGELIKILQRALFLHFRAGCQHSRIGQSGGGNPLSTIPPP

11.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make vpr using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here