Mediates tolerance to oxidative stresses (e.g. hydrogen peroxide H(2)O(2), diamide, menadione and tert-butyl hydroperoxide) by minimizing the negative effects of oxidation and monitoring photosynthesis during stress (PubMed:17092320). Promotes root development. Prevents premature aging (e.g. senescence and flowering). Involved in resistance against compatible pathogens such as Botrytis cinerea and Pseudomonas syringae pv. tomato (PubMed:21736589).

Belongs to the LEA type 3 family.

97 amino acids

MARSISNVKIVSAFVSRELSNAIFRRGYAATAAQGSVSSGGRSGAVASAVMKKKGVEESTQKISWVPDPKTGYYRPETGSNEIDAAELRAALLNNKQ

10.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SAG21 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here