Description
Rex escorts unspliced gag-pro-pol and singly spliced env mRNAs out of the nucleus of infected cells. These mRNAs carry a recognition sequence called Rex responsive element (RxRE or XRE) located at the 3' region of the long terminal repeat (LTR). This function is essential since most HTLV proteins are translated from unspliced or partially spliced pre-mRNAs that cannot exit the nucleus by the pathway used by fully processed cellular mRNAs (By similarity).
Family
Belongs to the deltaretrovirus Rex protein family.
Species
Human T-cell leukemia virus 3 (strain Pyl43)
Sequence
MPKTRKQRSRRPRNQRPSTPWPISQVSDRAFSTGTLSTFSATVYRPIGAPFLGGFVPLGYTAMPCWPRAPNIRLPGTPSMDALSAQLYNTLSLGSPPSPPKELPAPSRFSPPQPLLRPPRFLHPSSTPLKNTPPSETIASSSPWESSCQPCPSPTLGSGPKTSTPYGAAPSCVSTSISSPPP
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service