Rex escorts unspliced gag-pro-pol and singly spliced env mRNAs out of the nucleus of infected cells. These mRNAs carry a recognition sequence called Rex responsive element (RxRE or XRE) located at the 3' region of the long terminal repeat (LTR). This function is essential since most HTLV proteins are translated from unspliced or partially spliced pre-mRNAs that cannot exit the nucleus by the pathway used by fully processed cellular mRNAs (By similarity).

Belongs to the deltaretrovirus Rex protein family.

182 amino acids

MPKTRKQRSRRPRNQRPSTPWPISQVSDRAFSTGTLSTFSATVYRPIGAPFLGGFVPLGYTAMPCWPRAPNIRLPGTPSMDALSAQLYNTLSLGSPPSPPKELPAPSRFSPPQPLLRPPRFLHPSSTPLKNTPPSETIASSSPWESSCQPCPSPTLGSGPKTSTPYGAAPSCVSTSISSPPP

19.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rex using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here