Involved in a signaling pathway that modulates root auxin transport and auxin gradients. Acts partially by positively regulating the auxin carrier PIN2 and AUX1 (PubMed:19948787). Acts, together with GB1 as positive regulator of meristem initiation and branching. GB1 and NDL3 positively regulate basipetal inflorescence auxin transport and modulate MAX2 expression in shoots, which regulates organ and lateral meristem formation by the establishment and maintenance of auxin gradients (PubMed:24223735).

Belongs to the NDRG family.

347 amino acids

MVGLNNAVSLDIEEICNGGKEHHVKTCHGSVSVVVYGDQEKPALITYPDVALNYMSCFQGLFLCPEAVSLLLHNFCIYHISPPGHEFGAAPVCSNDPSPSVEDLADQILEVLNFFSLEAVMCMGITAGAYILSLFAIKHKERVLGLILISPLCKAPSWSEWFYYKVVSNLLYYYGMSGLLKDIFLQRYFSKEARGSSEVPERDVVHECRRLLGERHGSSLMRFLEAVNRRHDLTDGLKSLKCRTLIFVGDQSPFHSETLHMVTALDRKYSALVEVQACGSMVTEEQPHAMLIPMEFFFMGFGLYRPGRVSDSPRSPLSPSCISPELLSPESLGLKLKPIKTRVPTKC

38.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NDL3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here