Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates (By similarity).

Belongs to the glycosyl hydrolase 61 family.

349 amino acids

MKSTFGLLALAAAAKLVSAHATVHAVWINDVDQGAGNSADGYIRSPPNNSPITDVTSTDMTCNVNGKNPVAKTLSVKAGDKVTFEWHHDTRSDSDDIIASSHMGPVMVYMAPTEKGTAGNGWVKIAEEGYSNGKWAVANLIANRGKHSITVPDVPAGEYLLRPEIIALHEGNRQGGAQFYMECVQVKVTSAGTKTLPAGVSIPGAYKATDPGVLFDMYNSFTSYPIPGPAVWDGSSSGSSGSSGSSPATTTAPAVSVTAAPTKEAPVDTSATPTTFVTATKPATTAAPAAPSASSGSNSGSDSCNSGSASGSVKIYGQCGGQNYSGPTSCEAGLICKEWNPYYHQCVSA

35.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make eglD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here