Endonuclease that plays a role in DNA repair. Cleaves phosphodiester bonds on the 5' side of apurinic or apyrimidinic sites (AP sites). In addition to endonuclease activity, the ASFV enzyme has a proofreading 3'-5' exonuclease activity that is considerably more efficient in the elimination of a mismatch than in that of a correctly paired base. Displays 3'-phosphatase and 3'-repair diesterase activities. The single nucleotide gaps generated by the AP endonuclease are filled by the viral AP endonuclease and DNA ligase.

Belongs to the AP endonuclease 2 family.

296 amino acids

MFGAFVSHRLWSDSGCTTTCITNSIANYVAFGEQIGFPFKSAQVFIAGPRKAVINIQEDDKVELLKMIVKHNLWVVAHGTYLDVPWSRRSAFVTHFIQQELLICKEVGIKGLVLHLGAVEPELIVEGLKKIKPVEGVVIYLETPHNKHHTYKYSTMEQIKELFLRIRNTRLKQIGLCIDTAHIWSSGVNISSYNDAGQWLRSLENIHSVIPPSHIMFHLNDAATECGSGIDRHASLFEGMIWKSYSHKIKKSGLYCFVEYITRHQCPAILERNLGSSMQLQTALTAEFTTLKSLLK

33.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Ba71V-134 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here