Description
Involved in the biosynthesis of polyamines which are thought to support the growth of thermophilic microorganisms under high-temperature conditions. It seems that long-chain and branched-chain of polyamines effectively stabilize DNA and RNA, respectively. Catalyzes the irreversible transfer of a propylamine group from the amino donor S-adenosylmethioninamine (decarboxy-AdoMet) to norspermidine, spermidine and norspermine to yield norspermine, thermospermine and caldopentamine, respectively. It can also synthesize sym-norspermidine (bis(3-aminopropyl)amine) from 1,3-diaminopropane with a very low activity. The biosynthesis of caldohexamine and caldoheptamine from caldopentamine has been also observed.
Family
Belongs to the spermidine/spermine synthase family.
Species
Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
Sequence
MELGMFRLNIYQPGGPIGALYPVEKILYHGRSQYQEIMILVLRGFGKTLVLDGLIQSTESDEHIYHETLVHPAMTVHPNPRRVLILGGGEGATLREVLKHNTVEKAVMVDIDGEVVRVAREYLPEWHQGAFDDPRAQVVIMDGFEYIKEAARRGEDFDVIIMDLTDPFGPKIAAKLYTKEAIGLVKSVLRSDGILVTQAGCAALFPEAFEKVYGSVKSLFAHAEEYGVWVPSFMYVNSFVFASDKYRLTDLSMEEVDRRLRERGVETRFYSGLRHYTLIGLGGIRLLEGRGS
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service