Involved in the biosynthesis of polyamines which are thought to support the growth of thermophilic microorganisms under high-temperature conditions. It seems that long-chain and branched-chain of polyamines effectively stabilize DNA and RNA, respectively. Catalyzes the irreversible transfer of a propylamine group from the amino donor S-adenosylmethioninamine (decarboxy-AdoMet) to norspermidine, spermidine and norspermine to yield norspermine, thermospermine and caldopentamine, respectively. It can also synthesize sym-norspermidine (bis(3-aminopropyl)amine) from 1,3-diaminopropane with a very low activity. The biosynthesis of caldohexamine and caldoheptamine from caldopentamine has been also observed.

Belongs to the spermidine/spermine synthase family.

292 amino acids

MELGMFRLNIYQPGGPIGALYPVEKILYHGRSQYQEIMILVLRGFGKTLVLDGLIQSTESDEHIYHETLVHPAMTVHPNPRRVLILGGGEGATLREVLKHNTVEKAVMVDIDGEVVRVAREYLPEWHQGAFDDPRAQVVIMDGFEYIKEAARRGEDFDVIIMDLTDPFGPKIAAKLYTKEAIGLVKSVLRSDGILVTQAGCAALFPEAFEKVYGSVKSLFAHAEEYGVWVPSFMYVNSFVFASDKYRLTDLSMEEVDRRLRERGVETRFYSGLRHYTLIGLGGIRLLEGRGS

32.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make speE1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here