First step of the lipid cycle reactions in the biosynthesis of the cell wall peptidoglycan.

Belongs to the glycosyltransferase 4 family. MraY subfamily.

360 amino acids

MLMFLTHFAEHVTPFNVFRYITFRTGGAMITSALIVFLFGPTIINSLRVRQGKGQPIRADGPQTHFKKAGTPTMGGLMIMTGILASCLLWANLASVYVWVVLMVSVGFGAIGFYDDYLKVTKQSDKGFSGKARLGIEFLIAAIAAFTIMRAGQEPFSSSLTFPFVKQLVINLSWFFIPFAAFVMVGAGNAVNLTDGLDGLAIVPVMVAAASFGFIAYLSGNAIFADYLQIHFVPGTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMLGTVAVATKHEIVLAIIGGLFVMEALSVIIQVGFFKMTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIVAIILAMIGLSTLKLR

38.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mraY using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here