Description
Central enzyme in the extracellular metabolism of plasma lipoproteins. Synthesized mainly in the liver and secreted into plasma where it converts cholesterol and phosphatidylcholines (lecithins) to cholesteryl esters and lysophosphatidylcholines on the surface of high and low density lipoproteins (HDLs and LDLs). The cholesterol ester is then transported back to the liver. Has a preference for plasma 16:0-18:2 or 18:O-18:2 phosphatidylcholines. Also produced in the brain by primary astrocytes, and esterifies free cholesterol on nascent APOE-containing lipoproteins secreted from glia and influences cerebral spinal fluid (CSF) APOE- and APOA1 levels. Together with APOE and the cholesterol transporter ABCA1, plays a key role in the maturation of glial-derived, nascent lipoproteins. Required for remodeling high-density lipoprotein particles into their spherical forms (By similarity).
Family
Belongs to the AB hydrolase superfamily. Lipase family.
Sequence
FFTIWLDINMFLPLGVDCWIDNTRVVYNRSSGRMSNAPGVQIRVPGFGKTYSVEYLDDNKLAGYLHTLVQNLVNNAYVRDETVRAAPYDWRLAPSQQDEYYQKLAELVEEMYDAYGKPVFLIGHRLGCLHVLHFLLHQSWKGIPIMSNIKLKEEQRITTTSPWMFPAHHVWPEDHVFISTPNFNYTGQDFKRFFADLHFEEGWYMFLQSRDLLEGLPAPGVEVYCLYGVGRPTRYTYIYDHNFPYKDPVAILYEDGDETVATRSTELCGQWQGRQSQPVYLLPMNGTDHLNMVFSNKTL
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service