Involved in degradation of pectin, which causes soft-rod disease in plants.

388 amino acids

MAKGKKLSFSFHTYQDSVTGTEVVRLTPPDVICHRNYFYQKCFSNDGSKLLFGGAFDGPWNYYLLDLKTQQATQLTEGTGDNTFGGFLSPDDDALYYVKNVRNLMRVDLNTLEETNIYQVPDDWVGYGTWVANSDCTKMVGIEIKKEDWKPLTDWKKFQEFYFTNPCCRLIRIDLKTGEATTILKENQWLGHPIYRPGDDNTVAFCHEGPHDLVDARMWFINEDGSNMRKVKEHAPGESCTHEFWVPNGSALAYVSYLKGSTNRFICSVDPVTLENRQLTEMPPCSHLMSNYDGTLMVGDGCNAPVDVKDDGGYKIENDPFLYVFNMKTGKHFQVAQHNTSWEVLEGDRQVTHPHPSFTPDDKHILFTSDVDGKPALYLAKVPDSVWQ

44.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ogl using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here