Catalyzes the last step of neomycin B biosynthesis, i.e. the irreversible epimerization at C-5''' of neomycin C to give neomycin B. To a lesser extent, is also able to convert neomycin Y2 to neomycin Y1.

Belongs to the radical SAM superfamily.

299 amino acids

MTTDIVWPPPVRQVRAYRNIVVDGACNIRCTYCEVKKTKVDQPATIRSLDRIFAEYEPDAVLFRVESDGEITLYPKIVDHLQKRAAEGYRVEVLSNGTKLPRALEGRPDLLWVFSVDGHTEAMNAKRGLKQPQIDRILDAAVELGAELQTVYWGQPVEEVNAYIDLLESRGYRGLLHFMPLLAFKGRPLTVNLRYQDLHPADFLAPPEYFRRWNHIFETGRRDAVCDQITNGYNYQVSGDEIRMVKCDCYSVPKHLVHGFGPIREFDDWPCGTCIANQEFNNSRERMRVPQGRIPLPLV

34.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make neoN using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here