Envelope protein part of the entry-fusion complex responsible for the virus membrane fusion with host cell membrane during virus entry. Also plays a role in cell-cell fusion (syncytium formation) (By similarity).

Belongs to the chordopoxvirinae L5 family.

129 amino acids

MDRNINFSPVFIEPRFKHEFLLSPQRYFYILVFEVIVALIILNFFFKEEILYTFFPLAKPSKNSINSLLDRTMLKCEEDGSLMISRPSGIYSALSLDGSPVRISDCSLLLSSINGASSSTSPYSIFNRR

14.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FPV132 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here