Probable transporter that facilitates the transmembrane diffusion of an unknown substrate. Is not permeable to water, dihydroxyacetone, glycerol, urea, H(2)O(2) and D/L-lactic acid.

Belongs to the MIP/aquaporin (TC 1.A.8) family.

250 amino acids

MTGSWEARYAAEFFGTLILVLLGNGAVANAFLKNTTGNDDPGLANGGWLLVASGYGLGVMLPAMMFGSISGNHLNPAITIGQAVIGIFPWAHVAPYLIWQFLGAIAGQCLILALYWPHYRQTTDNEAVLGTFATSDHANSQLNGFVTEMVGTAVLIFGAMGLYRGMFFHQNIDIANIGVGLLIAAMVISLGGPTGPALNPARDLGPRLVHALFPVPNKGSSHWEYSWVPVVAPIVGAVIGIWIYKIFFGL

26.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make glpF5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here