Mediates positive regulation of the ptsG/glcA and glcB genes by functioning as an antiterminator factor of transcription via its interaction with the RNA-antiterminator (RAT) sequence located upstream of the ptsG/glcA gene.

Belongs to the transcriptional antiterminator BglG family. GlcT subfamily.

287 amino acids

MSNYVIEKTLNNNVIICTDENQHHEVVLIGKGIGFNKKKGMELSDSVMIDKVYKLEQKKDQDHYKALVEIADDNVLQTIIEAMDIITHADRTVVDKDLMVALTDHILFAYKRIKQHQFIKNPFLIETKQLYSESYQIAVSVIEHLNKLLDIEFPEDEIGFIALHIASSKDDLSLHEVRLTNEIINKSILIMEHDLKYKIDTNSIQYQRFIRHIQFLIRRLQKGEIIQVNDEFGNMLKAHYPLCYNIAVKIIKMMQQHLDVEVYEAELIYLTLHINHFTQQNEKNTNV

33.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make glcT using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here