Involved in the de novo purine biosynthesis. Catalyzes the transfer of formate to 5-phospho-ribosyl-glycinamide (GAR), producing 5-phospho-ribosyl-N-formylglycinamide (FGAR). Formate is provided by PurU via hydrolysis of 10-formyl-tetrahydrofolate.

Belongs to the PurK/PurT family.

393 amino acids

MTRIGTPLSPTATRVLLCGCGELGKEVVIELQRLGVEVIAVDRYANAPAMQVAHRSHVINMLDGAALRAVIEAEKPHFIVPEIEAIATATLVALEAEGFTVIPTARAAQLTMNREGIRRLAAEELDLPTSPYHFADTFEDYSKAVQDLGFPCVVKPVMSSSGKGQSLLRSADDVQKAWDYAQEGGRAGKGRVIIEGFIDFDYEITLLTVRHVGGTTFCAPVGHRQEKGDYQESWQPQAMSPVALAESERVAKAVTEALGGRGLFGVELFIKGDQVWFSEVSPRPHDTGLVTLISQDLSQFALHARAILGLPVPLIRQFGPSASAVILVEGQSTQTAFANLGAALSEPDTALRLFGKPEVNGQRRMGVALARDESIEAARAKATRASQAVVVEL

42.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make purT using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here