Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport. Binds one trans-parinaric acid molecule or two cis-parinaric acid molecules. Affinity for mono- and polyunsaturated fatty acids is higher than that for saturated ones. Affinity for fatty acid coenzyme A derivatives, lysophosphatidic acid, lysophospholipds, retinoids, bilirubin and bile salts is similar to or higher than that for fatty acids. Affinity for prostaglandins, peroxisomal proliferators, bezafibrate and clofibrate is moderate to low.

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

125 amino acids

AFSGTWQVYAQENYEAFLKVIGVAEDIIPHAKEIKPTIEIQQSGNSFTVTSTAQKKSTTNTFTIGKEAEITTMNGNKLRCTINMEDGKLVCKTEKFSHIQEVQGEEMIETLTSGSATLIRRSRKV

13.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fabp1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here