Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes. Binds cholesterol. Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

127 amino acids

MNFSGKYQVQTQENYEAFMKAVGMPDDIIQKGKDIKGVSEIVQNGKHFKFIITAGSKVIQNEFTLGEECEMEFMTGEKIKAVVQQEGDNKLVTTFKGIKSVTEFNGDTVTSTMTKGDVVFKRVSKRI

14.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FABP1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here