Has been implicated in the acquisition, storage, and transport of lipids, and may be important to the organism since it is incapable of synthesizing most of its lipids de novo.

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

133 amino acids

MEAFLGTWKMEKSEGFDKIMERLGVDFVTRKMGNLVKPNLIVTDLGGGKYKMRSESTFKTTECSFKLGEKFKEVTPDSREVASLITVENGVMKHEQDDKTKVTYIERVVEGNELKATVKVDEVVCVRTYSKVA

15.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FABP1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here