Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme. To a lesser extent, is also able to utilize other nucleotides such as CTP and GTP as substrates, producing the modified coenzymes, flavin cytosine dinucleotide (FCD) and flavin guanine dinucleotide (FGD), respectively. Does not catalyze the reverse reaction to produce FMN and ATP from FAD and PPi. Does not function as a glycerol-3-phosphate cytidylyltransferase, as previously annotated in the complete genome.

Belongs to the archaeal FAD synthase family.

149 amino acids

MKKRVVTAGTFDILHPGHYEILKFAKSLGDELIVIVARDETVKKLKGRKPIIPEEQRREMVEALKPVDKAILGSLKNKLEPILELKPDIIVLGPDQTTFDEETLKKELAKYNLYPEIVRFRGYKKCPFHSSFDIVKEIIRRFCNKEIKI

17.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ribL using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here