Functions in the early steps of protein synthesis of a small number of specific mRNAs. Acts by directing the binding of methionyl-tRNAi to 40S ribosomal subunits. In contrast to the eIF-2 complex, it binds methionyl-tRNAi to 40S subunits in a codon-dependent manner, whereas the eIF-2 complex binds methionyl-tRNAi to 40S subunits in a GTP-dependent manner.

Belongs to the WD repeat EIF2A family.

570 amino acids

MGDNLVYAVRSSEGFYLKRGLGKDAVTVFEQNKTSRDVACNVFAYSNNGQLFAYCDNQVTRVFEIATNKEILCVELKRTRKILFSPKDNFLLTFEPWAVYGPKTAENQKPEPNVRVYSLADGKHVSTFSAPKEASWEPQFSDDESLAARMVGSEVFFYTNMSFDRYDHKLVEKGATNFALSPGPAPNHVAVYVPAVGSTPARVRVHRVSESFPVVGNRTFFKSDKAVMTWNQRGQSLLILASVEVDKTNQSYYGEQSLYLINIQSGESVVVPLEKKGPIYAAKWNPNGREFAVCYGYMPAKVTFYNPRGVPIFDTIEGPRNDVFYNAFGNIVLICGFGNIAKGKMEFWDVETKKEIISIEVPNTTLFDWAPDGQHFVTCTTAPRLRIDNSYRFWHYTGRMLAETHFESPKELWEVRWRPMTGYNKFAIKELTKTDKMAAGLPIRKKDASHPLNNVPAGAVRQAGAYIPPHLRKPLGGGGSAGPPSAAAPTPGNQNQRPAQPRANGNGNAPQPFRPQQSEQERKAFQLKKKVEEIKVLKQRVANGDQLQPNQMEKIQRENEYLSELSKLTI

64 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make eif-2A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here