Description
Required for correct embryo patterning and cotyledon organogenesis. May regulate positively the gibberellin signaling pathway leading to germination, hypocotyl elongation, and leaf expansion. Involved in the cytokinin signaling pathway that promotes shoot regeneration, probably through transcriptional activation of target genes such as CUC1. Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity).
Family
Belongs to the AP2/ERF transcription factor family. ERF subfamily.
Species
Arabidopsis thaliana
Sequence
MEEAIMRLEGAEHRETNIHSLKRKPSRTSSTAPGSPGGVTTAKAASGAGASGVSTIRYRGVRRRPWGRYAAEIRDPLSKERRWLGTFDTAEEAACAYDCAARAMRGLKARTNFVYPMPSLDSYHHRIFSSPPMNMFLLRDVLNSQSLSPLTTFAYPPCNLSNVNDVVHESFTNVNDVCEDLSPKAKRSSTIENESLISNIFEPEPASSGLLQEIVQGFLPKPISQHASIPPKSNQQSVGVFPTMPESGFQTDVRLADFHVEGNGFGQVKYHGELGWADHENGFDSAKMQQNGNGGMFYQYCFHDDY
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service