Description
Plays a role in M1 macrophage polarization and is required for the proper regulation of gene expression during M1 versus M2 macrophage differentiation (By similarity). Might play a role in RELA/p65 and STAT1 phosphorylation and nuclear localization upon activation of macrophages (By similarity).
Sequence
MYPRSRVVGPGLGTSSSSRDHAGAGQHGELDLQQNQRQNLEVAEPKGPKLERQGHGDQRSTGTYTLIAPNETRRQKIQRIAEQELADLERWKQQNKAKPVHLVPQRLGGSQSEAEVRQKQQLQQMRSKYQQKLKRDEAIRIRKDAEEAELQRMKAIQREKSNKLEKKKQLQEDIRRATLREHHQSKTAELLSRLDTDRTNRSACNIAPPAAQSSRWKLPVLLRDPSRAGSQAHKDSPQKEDNQKLQKTRDGHQKNKLLETKGQHQEEERAQIHQAEHWRVNNAFLDRLQGKSQPGGVEQSGGCWNMNSTDGWGI
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service