Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome.

Belongs to the EF-Ts family.

275 amino acids

MANYTAADVKRLRELTGSGMMACKNALAEAEGDFDKAVEQLRIKGAKDVGKRAERTTAEGLVVSKDGVLLELDCETDFVAKNEDFLKLAESIVTVAAAAKPADVDALKALELDGKTVDTVIQEQSAKIGEKLVLSKIASFDGPVAVYLHKRSADLPPAVGVLVEYTGEGDAAAEAARGAAMQVAALKAKYVTRDEVPEDIVANERHIAEETARAEGKPEQALPKIIEGRVNGYFKDVVLTEQSSVQDSKKSVKAILDEAGVTIKRFVRFEVGASS

29.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tsf using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here