Protein expression services for RPH8A | Disease resistance protein RPH8A
Description
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. In contrast to RPP8, it does not specifically recognize the Emco5 avirulence protein from Hyaloperonospora parasitica.
Family
Belongs to the disease resistance NB-LRR family. RPP8/HRT subfamily.
Species
Arabidopsis thaliana
Length
910 amino acids
Sequence
MAEGFVSFGLEKLWDLLSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEGKGVKKHVRRLARFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVTELVCHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGEILQMDEYTIQGKLFQLLETGRYLVVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVSDNIGSQIVGGSCLDDNSLNSVYRILSLSYEDLPTHLKHCFLHLAHYPEDSKIYTQDLFNYWAAEGIYDGSTIQDSGEYYLEELVRRNLVIADNRYLISEFKIKNCQMHDMMREVCLSKAKEENFLQIIKDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKRNAKVRSLIVSRFEEDFWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLRLYGAVVSHLPSTMRNLKLLLYLNLSVHNEDLIHVPNVLKEMIELRYLSIPVKMDDKTKLELGDLVNLEYLYGFSTQHTSVTDLLRMTKLRNLTVSLSERYNFKTLSSSLRELRNLETLYVLFSRKTYMVDHMGEFVLDHFIHLKELGLVVRMSKIPDQHQFPPHLVHIFLFYCGMEEDPMPILEKLHHLKSVQLRYKAFVGRRMVCSKDGFTQLCALDISKQSELEDWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCDQ
Mass
105.3 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make RPH8A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here