Catalyzes the removal of dipeptides from the N-terminus of oligopeptides. Most efficiently cleaves the synthetic substrate Met-Leu-methylcoumaryl-7-amide (Met-Leu-MCA), and slowly hydrolyzes Leu-Gln-, Lys-Ala-, Leu-Arg, and Ala-Asn-MCA. Is likely involved in amino acid metabolism and bacterial growth/survival of asaccharolytic P.endodontalis, that utilizes amino acids from extracellular proteinaceous nutrients as energy and carbon sources.

Belongs to the peptidase S46 family.

818 amino acids

MKLKRILLSVALLCGIGTTAMADKGMWLLNELNQQNYERMKELGFKLSPEQLYSLGQPSVASAVVIFGGGCTGITVSNEGLIFTNHHCGFGAIQSQSTVDHDYLRDGFRSNNHVEELPIPGLSVRYLREIVDVTPRIEAAVKGAKSEMERMQIIEELSQKINAEYTKGSTVVGEVTPYYAGNKYYVVVYNVFQDVRLVMAPPSSVGKFGGDTDNWMWTRHTGDFSVFRVYADANNNPALYSQNNKPYKPISYAPVSLNGYREGDYAMTIGFPGSTNRYLTSWGVEDVVNNENSPRIEVRGIKQAIWKEAMEADQATRIKYASKYAQSSNYWKNSIGMNRGLKNLDVVNRKRAEEKAFEAWIAKNNSQSTYGHILPGLKADYAKSAAISKDINYLYETLWGGTEIVRLARDVNSVGRIQAADMPKYKGRLEELYKDYLPSLDVKVLPAMLDIVRQRVSADCQPDIFKFIDKKFKGSTEKYAQYVFEKSIVPYADKVKDFLNLPADKQKKILDKDPAVALFNSVLPAIMQAQDKSEEMMLNIEKGKREYFAASRIMDPNRQMPSDANFTMRMSYGSIKGYAPKDGAWYNYYTTEQGVFEKQDPTSSEFAVQPEILSLLRSKDFGQYGVGDHLRLCFLSDNDITGGNSGSPVFNGNGELIGLAFDGNWEAMSGDIEFEPDLQRTISVDIRYVLFMIDKWAKMPHLIKELNLVKGDQRDLMPAGKGGNCSHKKAQTCAKKECSKGKKCAEKSATCISAMKDGKPCKTEKACAAGQKSAEKKANCCSTMKDGKPCTGDKDCAKSGKACCGKNKEAAAKKASKK

91.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dpp7 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here