This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.

Belongs to the dUTPase family.

165 amino acids

MTADTQTPVTKVDQAPPLLIKKLSDKARLPTRGSAFAAGYDIYASKETTIPARGKGLVETDISMAVPAGTYGRIAPRSGLAAKNFIDVGAGVIDADYRGQVKVLLFNHSDVDFVVNEGDRVAQLVLERIYTPEVVEVEQLEESVRGAGGFGSTGVGSGVGEQMKN

17.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dut-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here