About Products Protein Database Contact

Protein expression services for polr2f | DNA-directed RNA polymerases I, II, and III subunit rpabc2

Description
DNA-dependent RNA polymerases catalyze the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB6 is part of the clamp element and together with parts of RPB1 and RPB2 forms a pocket to which the RPB4-RPB7 subcomplex binds (By similarity).
Family
Belongs to the archaeal RpoK/eukaryotic RPB6 RNA polymerase subunit family.
Species
Dictyostelium discoideum
Length
133 amino acids
Sequence
MADFEGGGDDGGYEEFDEGGGFEEEYVEETETTEAYTDIIDPSADANTAEAGRIPNHLRKTTRYMTKYERARLLGSRALQISMNAPIMVELEGETDPLQIAWKELRAKKIPLIIRRFLPNGMYEDWSVDELSI
Mass
15.1 kDa
Simulated SDS-PAGE
Western blot of polr2f recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make polr2f using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here