Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore (By similarity).

Belongs to the DASH complex DUO1 family.

194 amino acids

MNANGEANGGVDSAALDELIPQIFDQMRTNQLDGSGAAAWGTAAVSTATLLKEMEQLDQIIPVLQQLNESLRRSTGENLSRIRRTCEAVNRVLDTWIKIQSQAGYVGELMDDSEYLSYMEKTRGDEGQQQAYMESLRKQVEELRRKVDERRAVEAAAAAPRAPERTRGASGIPRGGSRITKRGGTTVRGRRMFR

21.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DUO1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here